Recombinant Dog Interleukin-8 (IL8)

Code CSB-YP011671DO
MSDS
Size US$436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
CXCL8; IL8; Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Source
Yeast
Expression Region
23-101aa
Target Protein Sequence
AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
11.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Gene References into Functions
  1. Analysis of ROC suggests the use of serum levels of MCP-1 and IL-7 as predictors of the occurrence of complications with an AUC of 0.906 and 0.896 respectively and linear combinations of MCP-1, KC-Like, IL-7 and GM-CSF with values up to AUC = 0.983 PMID: 29304171
  2. These observations indicate that the individual activation of ERK2 and JNK1 pathways contributes to TNF-alpha-induced IL-8 expression in synovial fibroblasts. PMID: 28806729
  3. data suggest that CCL2 acts as a PMNs chemotactic factor as well as CXCL8, and both CCL2 and CXCL8 facilitate the infiltration of PMNs into the joints of idiopathic polyarthritis PMID: 27863550
  4. The study findings suggest that both CCL2 and CXCL8 are involved in the pathogenesis of canine idiopathic pulmonary fibrosis. PMID: 26231926
  5. High CXCL8 blood concentrations might be related to the breed predisposition of the West Highland white terrier for canine idiopathic pulmonary fibrosis. PMID: 26267090
  6. IL-8-positive macrophages were significantly increased in large polyps compared to controls PMID: 24148828
  7. hemangiosarcoma derived IL-8 may play a role in tumor development by modulating the tumor microenvironment PMID: 24582862
  8. Data indicate that the Leishmania braziliensis antigens plus saponin (LBSap) vaccine induced high levels of IL-12, IL-10, CCL4, CCL5 and CXCL8 expression within 48 hours. PMID: 23911411
  9. serum and tumor levels of IL-8 and IL-10 in dogs bearing benign and malignant mammary tumors, including dogs with inflammatory mammary cancer, for a better understanding of this disease PMID: 23351639
  10. Sixty-one percent (28/46) of the samples from canine stifle osteoarthritis had IL-8 mRNA expression in contrast to 4% (1/24) in the control stifle joints PMID: 16102844
  11. Adipose tissue-derived mesenchymal stem cells expressed the mRNA of transforming growth factor beta (TGF-beta), IL-6, IL-8, CCL2, CCL5, VEGF,HGF, tissue inhibitor metalloproteinase-1/2, and cyclooxygenase-2 but not that of IL-10. PMID: 18717642

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*